COVID-19 CLOSURE

COVID-19 Closure

Due to the current situation with Covid 19 this facility is currently closed and all staff are working from home. Although we will be checking emails regularly, there may be a longer delay than usual in replying.

Polyclonal Antibodies

Displaying 351 - 400 of 581 available to order
Type Gene Name/Antigen Name Text Full Name Immuno Sequence Sheep No Type Price per aliquot (100µg) Add to cart
Antibodies PPM1D View Data protein phosphatase, Mg2+/Mn2+ dependent 1D PPM1D (588 - 599) KKIGNPLLHQHR [residues 588 - 599 of human] S479B Polyclonal Antibody £110.00
Antibodies PPM1E View Data protein phosphatase, Mg2+/Mn2+ dependent 1E PPM1E (495 - 755) GST-PPM1E (495 - 755) [DU 15986] S677C Polyclonal Antibody £110.00
Antibodies PPM1E View Data protein phosphatase, Mg2+/Mn2+ dependent 1E PPM1E (717 - 728) CRSSLPWRQNSWK [residues 717 - 728 of human + N-terminal cysteine for coupling] S097C Polyclonal Antibody £110.00
Antibodies PPM1E View Data protein phosphatase, Mg2+/Mn2+ dependent 1E PPM1E (506 - 526) NSFQGGQEDGGDDKENHGECK [residues 506 - 526 of human] S677C Polyclonal Antibody £110.00
Antibodies PPM1E View Data protein phosphatase, Mg2+/Mn2+ dependent 1E PPM1E (739 - 752) KTHDIPCPDLPWSY [residues 739 - 752 of human] S485B Polyclonal Antibody £110.00
Antibodies PPM1F View Data protein phosphatase, Mg2+/Mn2+ dependent 1F PPM1F (439 - 454) LPSSLPEPETQAPPRS [residues 439 - 454 of human] S504B Polyclonal Antibody £110.00
Antibodies PPM1G View Data protein phosphatase, Mg2+/Mn2+ dependent 1G PPM1G (525 - 540) VLSTEGAEENGNSDKK] [residues 525 - 540 of human] S486B Polyclonal Antibody £110.00
Antibodies PPM1H View Data protein phosphatase, Mg2+/Mn2+ dependent 1H PPM1H (1 - 514) His-SUMO-PPM1H (1 - 514) [DU 62835] DA018 Polyclonal Antibody £110.00
Antibodies PPP4R2 View Data PPP4R2 phospho Thr 251 INGPGT*PRPLNR [residues 246 - 257 of human] S694C Polyclonal Antibody £110.00
Antibodies PPP4R3 View Data PPP4R3 phospho Ser 741 CLSGRQS*PSFK [residues 736 - 745 of human] S704C Polyclonal Antibody £110.00
Antibodies PRAK View Data p38-regulated/activated kinase PRAK phospho Thr 182 QGDLMT*PQFTP [residues 177 - 187 of human] S084A Polyclonal Antibody £110.00
Antibodies PRAS40 View Data 40 kDa proline-rich AKT substrate PRAS40 (238 - 256) DLPRPRLNTSDFQKLKRKY [residues 238 - 256 of human] S115B Polyclonal Antibody £110.00
Antibodies PRAS40 View Data 40 kDa proline-rich AKT substrate PRAS40 phospho Thr 246 CRPRLNT*SDFQK [residues 240 - 251 of human + N-terminal cysteine for coupling] S114B Polyclonal Antibody £110.00
Antibodies PROTOR View Data Protein observed with Rictor-1 PROTOR1 GST-PROTOR1 (1 - 388) [DU 10413] [Accession number NM_181333] - Originally named PRR5 S020C Polyclonal Antibody £110.00
Antibodies PTEN View Data PTEN phospho Ser 370 Phosphatase and tensin homolog TPDVS*DNE [residues 366 - 373 of human] S570B Polyclonal Antibody £110.00
Antibodies PTEN View Data PTEN phospho Thr 366 Phosphatase and tensin homolog TSVT*PDV [residues 363 - 369 of human] S663B Polyclonal Antibody £110.00
Antibodies RAB10 View Data RAB10 phospho Thr 73 AGQERFHT*ITTSYYR [residues 66 - 80 of human] S873D Polyclonal Antibody £110.00
Antibodies RAB10 View Data RAB10, member RAS oncogene family RAB10 (131 - 155) CTPVKEPNSENVDISSGGGVTGWKSK [residues 131 - 155 of human] S945D Polyclonal Antibody £110.00
Antibodies RAB12 View Data RAB12 RAB12 [DU 52221] SA227 Polyclonal Antibody £110.00
Antibodies RAB12 View Data RAB12 phospho Ser 106 AGQERFNS*ITSAYYR [residues 99 - 113] S876D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family Rab13 MBP-Rab13 [Du 43886] S806D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family pseudogene Rab13 phospho Ser 111 KSIKENAS*AGVERLR [residues 104 - 117 of human] S505D Polyclonal Antibody £110.00
Antibodies RAB1A View Data RAB1A phospho Ser 114 CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] S817D Polyclonal Antibody £110.00
Antibodies RAB1B View Data RAB1B phospho Ser 111 CQEIDRYAS*ENVNKLR [residues 104 - 118 of human] S817D Polyclonal Antibody £110.00
Antibodies Rab35 View Data RAB35 phospho Thr 72 AGQERFRT*ITSTYYR [residues 65 - 79 of human] SA083 Polyclonal Antibody £110.00
Antibodies RAB35 View Data RAB35 GST-RAB35 [DU 26867] SA314 Polyclonal Antibody £110.00
Antibodies RAB39B View Data RAB39B GST-RAB39B [DU 43849] S935D Polyclonal Antibody £110.00
Antibodies Rab3A View Data RAB3A phospho Thr 86 AGQERYRT*ITTAYYR [residues 79 - 93 of human] SA082 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 GST-RAB43 [DU 50329] SA135 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 phospho Thr 82 CAGQERFRT*ITQSYYR [residues 75 - 89 of human] SA334 Polyclonal Antibody £110.00
Antibodies RAB5A View Data RAB5A, member RAS oncogene family RAB5A phospho Ser 84 AGQERYHS*LAPMYYR [residues 77 - 91 of human] S942D Polyclonal Antibody £110.00
Antibodies Rab7A View Data RAB7A GST-RAB7A (mouse) [DU 46688] S824D Polyclonal Antibody £110.00
Antibodies RAB7A View Data RAB7A phospho Ser 72 AGQERFQS*LGVAFYR [residues 65 - 79 of human] S875D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Thr 71 IAGQERFT*SMTRLYYR [residues 64 - 9 of human] S877D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L (1 - 203) His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Ser 72 DIAGQERFTS*MTRLYYRSS [residues 63 - 91 of human] SA136 Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A phospho Thr 72 AGQERFRT*ITTAYYR [residues 65 - 79 of human] S874D Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A (172 - 203) CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human] S969D Polyclonal Antibody £110.00
Antibodies Rab8A View Data RAB8A, member RAS oncogene family Rab8A MBP-Rab8A [Du 16222] S804D Polyclonal Antibody £110.00
Antibodies Rab8a View Data RAB8A, member RAS oncogene family Rab8a phospho Ser 111 RNIEEHAS*ADVEKMR [residues 104 - 117 of human] S503D Polyclonal Antibody £110.00
Antibodies Rab8B View Data RAB8B, member RAS oncogene family Rab8B MBP-Rab8B [Du 43885] S805D Polyclonal Antibody £110.00
Antibodies Rab8b View Data RAB8B, member RAS oncogene family Rab8b phospho Ser 111 RNIEEHAS*SDVERMR [residues 104 - 117 of human] S504D Polyclonal Antibody £110.00
Antibodies RanBP2 View Data RAN binding protein 2 GST-RanBP2 (2553 - 2838) GST-RanBP2 (2553 - 2838) [DU 41169] S363D Polyclonal Antibody £110.00
Antibodies RAP1GAP2 View Data RAP1 GTPase activating protein 2 RAP1GAP2 (260 - 480) GST-RAP1GAP2 (260 - 480) [DU 41252] S376D Polyclonal Antibody £110.00
Antibodies Raptor View Data Regulatory Associated Protein Of MTOR Raptor (1 - 20) MESEMLQSPLLGLGEEDEAD [residues 1 - 20 of human] S260D Polyclonal Antibody £110.00
Antibodies RASSF7 View Data Ras association domain family member 7 RASSF7 phospho Ser 111 CKKRCLIRAS*LPVKPR [residues 105 - 117 of human] SA360 Polyclonal Antibody £110.00
Antibodies REEP1 View Data Receptor Accessory Protein 1 GST-REEP1 (65 - end) GST-REEP1 (65 - end) [DU 31162] S280D Polyclonal Antibody £110.00
Antibodies REEP2 View Data Receptor Accessory Protein 2 GST-REEP2 (169 - end) GST-REEP2 (169 - end) [DU 40147] S301D Polyclonal Antibody £110.00
Antibodies REEP4 View Data Receptor Accessory Protein 4 GST-REEP4 (65 - end) GST-REEP4 (65 - end) [DU 36488] S281D Polyclonal Antibody £110.00
Antibodies REPS1 View Data RALBP1 Associated Eps Domain Containing 1 REPS1 phospho Ser 537 VTRQRSHS*GTSPDNT [residues 530 - 544 of human] S249D Polyclonal Antibody £110.00

Pages

Do you need any help? Please get in touch and we’ll be happy to lend a hand.