
Displaying 301 - 350 of 536 available to order
Type Gene Name/Antigen Name Text Full Name Immuno Sequence Sheep No Type Price per aliquot (100µg) Add to cart
Antibodies PDE3 View Data Phosphodiesterase 3 PDE3A phospho Ser 312 SHRRTS*LPCIP [residues 307 - 317 of human] S712A Polyclonal Antibody £110.00
Antibodies PDE3 View Data Phosphodiesterase 3 PDE3A phospho Ser 465 RDRSTS*IKLQEAP [residues 460 - 472 of human] S556B Polyclonal Antibody £110.00
Antibodies PDE3 View Data Phosphodiesterase 3 PDE3A phospho Ser 428 KRLRRS*LPPGL [residues 423 - 433 of human] S446B Polyclonal Antibody £110.00
Antibodies PDE3 View Data Phosphodiesterase 3 PDE3A (1095 - 1110) RLAGIENQSLDQTPQS [residues 1095 - 1110 of human] S721A Polyclonal Antibody £110.00
Antibodies Pellino1 View Data pellino homolog 1 Pellino1 phospho Thr288 / Thr290 CPVGFNT*LAFPS [residues 282 - 293 of human] S393C Polyclonal Antibody £110.00
Antibodies PFK2 View Data 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 GST-PFK2 GST-PFK2 [DU 36862] S244D Polyclonal Antibody £110.00
Antibodies PFK2 View Data 6-phosphofructo-2-kinase; fructose-2,6-biphosphatase 2 PFK2 (1 - 30) [DU 40650] GST-PFK2 (1 - 30) [DU 40650] S410D Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 MBP-PINK1 (122 - 496 mouse) MBP-PINK1 (112 - 496 mouse) [DU 17569] S857C Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 phospho Thr 257 CAGEYGAVT*YRKSKR [residues 250 - 262 of human] S114D Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 (175 - 250 human) GST-PINK1 (175 - 250 human) [DU 34557] S085D Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK (235 - end mouse) PINK (235 - end mouse MBP cleaved) [DU 17570] S774C Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK (125 - end) MBP-PINK (125 - end) [DU 17108] S514C Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 MBP-PINK1 (1-128-end Tribolium) MBP-PINK1 (1-128-end Tribolium) DU 34759 S121D Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 (104 - 127 mouse) FGLGLGLIEEKQAEGRRAASACQE [residues 104 - 127 of mouse] S889C Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 (175 - 250 mouse) GST-PINK1 (175 - 250 mouse) [DU 34559] S086D Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK (125 - 539) PINK (125 - 539) MBP cleaved [DU 13946] S460C Polyclonal Antibody £110.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK (186 - 202) KSTGLLPGRGPGTSAPG [residues 186 - 202 of human] S688B Polyclonal Antibody £110.00
Antibodies PKB View Data Protein Kinase B PKB gamma (116 -127) RMNCSPTSQIDN [residues 116 - 127 of human] S697B Polyclonal Antibody £110.00
Antibodies PKB View Data Protein Kinase B PKB alpha His-PKB alpha S742B Polyclonal Antibody £110.00
Antibodies PKB View Data Protein Kinase B PKB beta (455 - 469) RYDSLDPLELDQRTH [residues 455 - 469 of mouse] S069C Polyclonal Antibody £110.00
Antibodies PRAK View Data p38-regulated/activated kinase PRAK phospho Thr 182 QGDLMT*PQFTP [residues 177 - 187 of human] S084A Polyclonal Antibody £110.00
Antibodies PRAS40 View Data 40 kDa proline-rich AKT substrate PRAS40 (238 - 256) DLPRPRLNTSDFQKLKRKY [residues 238 - 256 of human] S115B Polyclonal Antibody £110.00
Antibodies PROTOR View Data Protein observed with Rictor-1 PROTOR1 GST-PROTOR1 (1 - 388) [DU 10413] [Accession number NM_181333] - Originally named PRR5 S020C Polyclonal Antibody £110.00
Antibodies PTEN View Data PTEN phospho Thr 366 Phosphatase and tensin homolog TSVT*PDV [residues 363 - 369 of human] S663B Polyclonal Antibody £110.00
Antibodies PTEN View Data PTEN phospho Ser 370 Phosphatase and tensin homolog TPDVS*DNE [residues 366 - 373 of human] S570B Polyclonal Antibody £110.00
Antibodies RAB10 View Data RAB10, member RAS oncogene family RAB10 (131 - 155) CTPVKEPNSENVDISSGGGVTGWKSK [residues 131 - 155 of human] S945D Polyclonal Antibody £110.00
Antibodies RAB10 View Data RAB10 phospho Thr 73 AGQERFHT*ITTSYYR [residues 66 - 80 of human] S873D Polyclonal Antibody £110.00
Antibodies RAB12 View Data RAB12 RAB12 [DU 52221] SA227 Polyclonal Antibody £110.00
Antibodies RAB12 View Data RAB12 phospho Ser 106 AGQERFNS*ITSAYYR [residues 99 - 113] S876D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family pseudogene Rab13 phospho Ser 111 KSIKENAS*AGVERLR [residues 104 - 117 of human] S505D Polyclonal Antibody £110.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family Rab13 MBP-Rab13 [Du 43886] S806D Polyclonal Antibody £110.00
Antibodies RAB1A View Data RAB1A phospho Ser 114 CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] S817D Polyclonal Antibody £110.00
Antibodies RAB1B View Data RAB1B phospho Ser 111 CQEIDRYAS*ENVNKLR [residues 104 - 118 of human] S817D Polyclonal Antibody £110.00
Antibodies RAB35 View Data RAB35 GST-RAB35 [DU 26867] SA314 Polyclonal Antibody £110.00
Antibodies Rab35 View Data RAB35 phospho Thr 72 AGQERFRT*ITSTYYR [residues 65 - 79 of human] SA083 Polyclonal Antibody £110.00
Antibodies RAB39B View Data RAB39B GST-RAB39B [DU 43849] S935D Polyclonal Antibody £110.00
Antibodies Rab3A View Data RAB3A phospho Thr 86 AGQERYRT*ITTAYYR [residues 79 - 93 of human] SA082 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 GST-RAB43 [DU 50329] SA135 Polyclonal Antibody £110.00
Antibodies RAB43 View Data RAB43 phospho Thr 82 CAGQERFRT*ITQSYYR [residues 75 - 89 of human] SA334 Polyclonal Antibody £110.00
Antibodies RAB5A View Data RAB5A, member RAS oncogene family RAB5A phospho Ser 84 AGQERYHS*LAPMYYR [residues 77 - 91 of human] S942D Polyclonal Antibody £110.00
Antibodies Rab7A View Data RAB7A GST-RAB7A (mouse) [DU 46688] S824D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L (1 - 203) His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Thr 71 IAGQERFT*SMTRLYYR [residues 64 - 9 of human] S877D Polyclonal Antibody £110.00
Antibodies RAB7L View Data RAB7L phospho Ser 72 DIAGQERFTS*MTRLYYRSS [residues 63 - 91 of human] SA136 Polyclonal Antibody £110.00
Antibodies Rab8A View Data RAB8A, member RAS oncogene family Rab8A MBP-Rab8A [Du 16222] S804D Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A (172 - 203) CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human] S969D Polyclonal Antibody £110.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A phospho Thr 72 AGQERFRT*ITTAYYR [residues 65 - 79 of human] S874D Polyclonal Antibody £110.00
Antibodies Rab8a View Data RAB8A, member RAS oncogene family Rab8a phospho Ser 111 RNIEEHAS*ADVEKMR [residues 104 - 117 of human] S503D Polyclonal Antibody £110.00
Antibodies Rab8b View Data RAB8B, member RAS oncogene family Rab8b phospho Ser 111 RNIEEHAS*SDVERMR [residues 104 - 117 of human] S504D Polyclonal Antibody £110.00
Antibodies Rab8B View Data RAB8B, member RAS oncogene family Rab8B MBP-Rab8B [Du 43885] S805D Polyclonal Antibody £110.00


Do you need any help? Please get in touch and we’ll be happy to lend a hand.