
Displaying 301 - 350 of 509 available to order
Type Gene Name/Antigen Name Text Full Name Immuno Sequence Sheep No Type Price per aliquot (100µg) Add to cart
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 (104 - 127 mouse) FGLGLGLIEEKQAEGRRAASACQE [residues 104 - 127 of mouse] S889C Polyclonal Antibody £100.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 (175 - 250 mouse) GST-PINK1 (175 - 250 mouse) [DU 34559] S086D Polyclonal Antibody £100.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK (125 - end) MBP-PINK (125 - end) [DU 17108] S514C Polyclonal Antibody £100.00
Antibodies PINK View Data PTEN induced putative kinase 1 MBP-PINK1 (122 - 496 mouse) MBP-PINK1 (112 - 496 mouse) [DU 17569] S857C Polyclonal Antibody £100.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK (125 - 539) PINK (125 - 539) MBP cleaved [DU 13946] S460C Polyclonal Antibody £100.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 phospho Thr 257 CAGEYGAVT*YRKSKR [residues 250 - 262 of human] S114D Polyclonal Antibody £100.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK1 (175 - 250 human) GST-PINK1 (175 - 250 human) [DU 34557] S085D Polyclonal Antibody £100.00
Antibodies PINK View Data PTEN induced putative kinase 1 PINK (186 - 202) KSTGLLPGRGPGTSAPG [residues 186 - 202 of human] S688B Polyclonal Antibody £100.00
Antibodies PKB View Data Protein Kinase B PKB alpha His-PKB alpha S742B Polyclonal Antibody £100.00
Antibodies PKB View Data Protein Kinase B PKB beta (455 - 469) RYDSLDPLELDQRTH [residues 455 - 469 of mouse] S069C Polyclonal Antibody £100.00
Antibodies PKB View Data Protein Kinase B PKB gamma (116 -127) RMNCSPTSQIDN [residues 116 - 127 of human] S697B Polyclonal Antibody £100.00
Antibodies PRAK View Data p38-regulated/activated kinase PRAK phospho Thr 182 QGDLMT*PQFTP [residues 177 - 187 of human] S084A Polyclonal Antibody £100.00
Antibodies PRAS40 View Data 40 kDa proline-rich AKT substrate PRAS40 (238 - 256) DLPRPRLNTSDFQKLKRKY [residues 238 - 256 of human] S115B Polyclonal Antibody £100.00
Antibodies PROTOR View Data Protein observed with Rictor-1 PROTOR1 GST-PROTOR1 (1 - 388) [DU 10413] [Accession number NM_181333] - Originally named PRR5 S020C Polyclonal Antibody £100.00
Antibodies PTEN View Data PTEN phospho Ser 370 Phosphatase and tensin homolog TPDVS*DNE [residues 366 - 373 of human] S570B Polyclonal Antibody £100.00
Antibodies PTEN View Data PTEN phospho Thr 366 Phosphatase and tensin homolog TSVT*PDV [residues 363 - 369 of human] S663B Polyclonal Antibody £100.00
Antibodies RAB10 View Data RAB10 phospho Thr 73 AGQERFHT*ITTSYYR [residues 66 - 80 of human] S873D Polyclonal Antibody £100.00
Antibodies RAB10 View Data RAB10, member RAS oncogene family RAB10 (131 - 155) CTPVKEPNSENVDISSGGGVTGWKSK [residues 131 - 155 of human] S945D Polyclonal Antibody £100.00
Antibodies RAB12 View Data RAB12 phospho Ser 106 AGQERFNS*ITSAYYR [residues 99 - 113] S876D Polyclonal Antibody £100.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family Rab13 MBP-Rab13 [Du 43886] S806D Polyclonal Antibody £100.00
Antibodies Rab13 View Data RAB13, member RAS oncogene family pseudogene Rab13 phospho Ser 111 KSIKENAS*AGVERLR [residues 104 - 117 of human] S505D Polyclonal Antibody £100.00
Antibodies RAB1A View Data RAB1A phospho Ser 114 CQEIDRYAS*ENVNKLR [residues 107 - 120 of human] S817D Polyclonal Antibody £100.00
Antibodies RAB1B View Data RAB1B phospho Ser 111 CQEIDRYAS*ENVNKLR [residues 104 - 118 of human] S817D Polyclonal Antibody £100.00
Antibodies RAB39B View Data RAB39B GST-RAB39B [DU 43849] S935D Polyclonal Antibody £100.00
Antibodies Rab7A View Data RAB7A GST-RAB7A (mouse) [DU 46688] S824D Polyclonal Antibody £100.00
Antibodies RAB7L View Data RAB7L (1 - 203) His-SUMO-RAB7L (1 - 203) [DU 50291] S984D Polyclonal Antibody £100.00
Antibodies RAB7L View Data RAB7L phospho Thr 71 IAGQERFT*SMTRLYYR [residues 64 - 9 of human] S877D Polyclonal Antibody £100.00
Antibodies Rab8a View Data RAB8A, member RAS oncogene family Rab8a phospho Ser 111 RNIEEHAS*ADVEKMR [residues 104 - 117 of human] S503D Polyclonal Antibody £100.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A (172 - 203) CKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFR [residues 172 - 203 of human] S969D Polyclonal Antibody £100.00
Antibodies Rab8A View Data RAB8A, member RAS oncogene family Rab8A MBP-Rab8A [Du 16222] S804D Polyclonal Antibody £100.00
Antibodies RAB8A View Data RAB8A, member RAS oncogene family RAB8A phospho Thr 72 AGQERFRT*ITTAYYR [residues 65 - 79 of human] S874D Polyclonal Antibody £100.00
Antibodies Rab8b View Data RAB8B, member RAS oncogene family Rab8b phospho Ser 111 RNIEEHAS*SDVERMR [residues 104 - 117 of human] S504D Polyclonal Antibody £100.00
Antibodies Rab8B View Data RAB8B, member RAS oncogene family Rab8B MBP-Rab8B [Du 43885] S805D Polyclonal Antibody £100.00
Antibodies RanBP2 View Data RAN binding protein 2 GST-RanBP2 (2553 - 2838) GST-RanBP2 (2553 - 2838) [DU 41169] S363D Polyclonal Antibody £100.00
Antibodies RAP1GAP2 View Data RAP1 GTPase activating protein 2 RAP1GAP2 (260 - 480) GST-RAP1GAP2 (260 - 480) [DU 41252] S376D Polyclonal Antibody £100.00
Antibodies Raptor View Data Regulatory Associated Protein Of MTOR Raptor (1 - 20) MESEMLQSPLLGLGEEDEAD [residues 1 - 20 of human] S260D Polyclonal Antibody £100.00
Antibodies REEP1 View Data Receptor Accessory Protein 1 GST-REEP1 (65 - end) GST-REEP1 (65 - end) [DU 31162] S280D Polyclonal Antibody £100.00
Antibodies REEP2 View Data Receptor Accessory Protein 2 GST-REEP2 (169 - end) GST-REEP2 (169 - end) [DU 40147] S301D Polyclonal Antibody £100.00
Antibodies REEP4 View Data Receptor Accessory Protein 4 GST-REEP4 (65 - end) GST-REEP4 (65 - end) [DU 36488] S281D Polyclonal Antibody £100.00
Antibodies REPS1 View Data RALBP1 Associated Eps Domain Containing 1 REPS1 phospho Ser 537 VTRQRSHS*GTSPDNT [residues 530 - 544 of human] S249D Polyclonal Antibody £100.00
Antibodies Ribosomal S6 protein View Data Ribosomal S6 protein Ribosomal S6 protein phospho Ser 235 AKRRRKS*SLRASTS [residues 229 - 242 of human] S441A Polyclonal Antibody £100.00
Antibodies Rictor View Data rapamycin-insensitive companion of mTOR Rictor (6 - 20) RGRSLKNLRVRGRND [residues 6 – 20 of human] S654B Polyclonal Antibody £100.00
Antibodies RNF12 View Data RNF12 (1 - 271 mouse) GST-RNF12 (1 - 271 mouse) [DU 49042] S691D Polyclonal Antibody £100.00
Antibodies RNF12 View Data RNF12 (mouse) GST-RNF12 (mouse) [DU 49041] S708D Polyclonal Antibody £100.00
Antibodies RNF7 View Data Ring Finger Protein 7 RNF7 GST-RNF7 [DU 21923] S299D Polyclonal Antibody £100.00
Antibodies RSK2 (MAPKAP_K1) View Data MAPK-activated protein kinase-1 RSK2 (712 - 734) RNQSPVLEPVGRSTLAQRRGIKK [residues 712 - 734 of human] S382 Polyclonal Antibody £100.00
Antibodies RSK2 (MAPKAP_K1) View Data MAPK-activated protein kinase-1 RSK2 (712 - 734) RNQSPVLEPVGRSTLAQRRGIKK [residues 712 - 734 of human] S382 Polyclonal Antibody £100.00
Antibodies RTT101 View Data Regulator of Ty1 Transposition RTT101 (460 - 660) GST-RTT101 (460 - 660 S. cerevisiae) [DU 21754] S245D Polyclonal Antibody £100.00
Antibodies SAKS1 View Data SAKS1 GST-SAKS1 S736A Polyclonal Antibody £100.00
Antibodies SAKS1 View Data SAKS1 phospho Ser 200 PGPVPS*SPSQEPP [residues 195 - 207 of human] S747A Polyclonal Antibody £100.00


Do you need any help? Please get in touch and we’ll be happy to lend a hand.